Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

2,491 – 2,505 of 115,729 results

2,491

Novus Biologicals™ IMPA1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	IMPA1
Molecular Weight (g/mol)	32.3kDa
Gene ID (Entrez)	3612
Immunogen	IMPA1, 1-277aa. Sequence: MGSSHHHHHHSSGLVPRGSHMADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

2,492

Novus Biologicals™ Recombinant Human Ornithine Decarboxylase His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,493

Novus Biologicals™ Collagen IV Native Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,494

R&D Systems™ Recombinant Human B7-2/CD86 Fc Chimera (CHO-expressed)

A New rh B7-2 protein is Available! It is HEK293 expressed with a His-tag!

Pricing & Availability

2,495

R&D Systems™ Recombinant Mouse IFN-kappa Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE with silver staining
Conjugate	Unconjugated
Molecular Weight (g/mol)	21kDa
Quantity	10 μg
Termination	Leu22
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived mouse IFN-kappa protein Leu22-Lys199
Name	IFN-kappa
Accession Number	Q7TSL0
Regulatory Status	RUO
Preparation Method	Reconstitute at 200μg/mL in sterile water.
Gene ID (Entrez)	56832
Quality Control Testing	SDS-PAGE: 19-22kDa, reducing conditions
Shelf Life	365 days
Recombinant	Recombinant

2,496

R&D Systems™ Recombinant Human Carbonic Anhydrase II Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

2,497

Novus Biologicals™ Recombinant Human Frataxin His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,498

Novus Biologicals™ Recombinant Human Aspartate beta hydroxylase His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,499

Novus Biologicals™ Recombinant Human Annexin A2 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

2,500

Novus Biologicals™ Recombinant Human PARP Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,501

Novus Biologicals™ Ornithine Decarboxylase Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,502

Novus Biologicals™ Recombinant Human XTP3TPA His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,503

Novus Biologicals™ Recombinant Human NEK7 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,504

R&D Systems™ Recombinant Human IL-10 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

2,505

Invitrogen™ Mouse IL-10 (ELISA Standard) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	18 kDa
Common Name	IL-10
Gene Symbol	IL10
Storage Requirements	4°C
Sequence	Mouse IL-10, amino acids Ser19-Ser178 (Accession # NM_010548) with a Cys149Tyr substitution
Expression System	E. coli
For Use With (Application)	Neutralization,ELISA Standard
Name	Mouse IL-10 (ELISA Standard)
Accession Number	P18893
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	CSIF; cytokine; Cytokine synthesis inhibitory factor; GVHDS; H-IL-10; il 10; IL10; IL-10; IL-10 precursor; IL10A; IL10X; ILN; Interleukin; interleukin 10; Interleukin10; interleukin-10; MGC126450; MGC126451; RP11-262N9.1; T-cell growth inhibitory factor; TGIF
Product Type	Protein
Gene ID (Entrez)	16153
Formulation	Protein with no preservative
Recombinant	Recombinant

Prev
1
...
165
166
167
168
...
7,716
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ IMPA1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Ornithine Decarboxylase His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Collagen IV Native Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Frataxin His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Aspartate beta hydroxylase His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Annexin A2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PARP Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Ornithine Decarboxylase Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human XTP3TPA His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NEK7 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ IMPA1 Protein

Novus Biologicals™ Recombinant Human Ornithine Decarboxylase His Protein

Novus Biologicals™ Collagen IV Native Protein

Novus Biologicals™ Recombinant Human Frataxin His Protein

Novus Biologicals™ Recombinant Human Aspartate beta hydroxylase His Protein

Novus Biologicals™ Recombinant Human Annexin A2 His Protein

Novus Biologicals™ Recombinant Human PARP Protein

Novus Biologicals™ Ornithine Decarboxylase Protein

Novus Biologicals™ Recombinant Human XTP3TPA His Protein

Novus Biologicals™ Recombinant Human NEK7 His Protein